PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.U009700.1.p
Common NameGLYMA_U009700, LOC102670152
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YB
Protein Properties Length: 109aa    MW: 12184.9 Da    PI: 9.0229
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.U009700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1406.1e-4423108287
              NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                        reqdrflPianvsrimkk+lPan kisk +ketvqe vs  isf+ ++as+kcqrekrktingddllwa++tlGfedy+eplk yl
  Glyma.U009700.1.p  23 REQDRFLPIANVSRIMKKTLPANVKISKYTKETVQEYVSALISFIIDKASNKCQREKRKTINGDDLLWAMTTLGFEDYLEPLKGYL 108
                        89*********************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.3E-4022108IPR009072Histone-fold
SuperFamilySSF471132.33E-3125108IPR009072Histone-fold
PfamPF008083.7E-202892IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.7E-135674No hitNo description
PRINTSPR006151.7E-137593No hitNo description
PRINTSPR006151.7E-1394108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MADSDNDSDG AHNSGKGVKL LSREQDRFLP IANVSRIMKK TLPANVKISK YTKETVQEYV  60
SALISFIIDK ASNKCQREKR KTINGDDLLW AMTTLGFEDY LEPLKGYL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-3723108287Transcription factor HapC (Eurofung)
4g92_B5e-3723108287Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.290901e-119cotyledon
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014628579.14e-76PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233104e-54NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLI1LKL84e-76I1LKL8_SOYBN; Uncharacterized protein
STRINGGLYMA11G18190.11e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-55nuclear factor Y, subunit B3